The domain within your query sequence starts at position 1 and ends at position 195; the E-value for the AP-5_subunit_s1 domain shown below is 6.7e-66.

MVHAFLIHTLRAPNLEDTGLCRVLYSCVFGAEKSPDDPRSHGAERDRLFRKEQILAVARQ
VESLCRLQQQAAGCSSTDLQPQFSAEPVSLHEAPHGAFHLAAGDPFQEPRTVLWLGILSL
GFALVLDTHENLLLAERTLRLLARLLLDHLRLLTPGTNFLLRADRIEGILTRFLPHGQLL
FLNDQFVQDLEKEFS

AP-5_subunit_s1

AP-5_subunit_s1
PFAM accession number:PF15001
Interpro abstract (IPR029392):

This family of proteins are subunits of the adaptor protein complex AP-5, which is involved in endosomal sorting and has links with hereditary spastic paraplegia [ (PUBMED:22022230) (PUBMED:23825025) ]. It is required for efficient homologous recombination DNA double-strand break repair [ (PUBMED:20613862) ].

GO process:double-strand break repair via homologous recombination (GO:0000724), endosomal transport (GO:0016197)
GO component:AP-type membrane coat adaptor complex (GO:0030119)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AP-5_subunit_s1