SMART: Pfam domain APG6

The domain within your query sequence starts at position 133 and ends at position 444; the E-value for the APG6 domain shown below is 1.1e-131.

PLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQRELKELALEEERL
IQELEDVEKNRKVVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQV
RYAQIQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLL
HALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLD
CVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLT
NLKWGLAWVSSQ

APG6

PFAM accession number:	PF04111
Interpro abstract (IPR040455):	In yeast, 15 Atg proteins coordinate the formation of autophagosomes. Autophagy is a bulk degradation process induced by starvation in eukaryotic cells [ (PUBMED:11689437) ]. Atg6/Vps30 has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway [ (PUBMED:9712845) ]. This entry is the beta-alpha repeated, autophagy-specific (BARA) domain [ (PUBMED:22437838) ].

PFAM accession number:

PF04111

Interpro abstract (IPR040455):

In yeast, 15 Atg proteins coordinate the formation of autophagosomes. Autophagy is a bulk degradation process induced by starvation in eukaryotic cells [ (PUBMED:11689437) ]. Atg6/Vps30 has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway [ (PUBMED:9712845) ]. This entry is the beta-alpha repeated, autophagy-specific (BARA) domain [ (PUBMED:22437838) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry APG6