The domain within your query sequence starts at position 21 and ends at position 113; the E-value for the APOBEC_N domain shown below is 1e-13.

HEFEVFFDPRELRKETCLLYEINWGGRHSVWRHTSQNTSNHVEVNFLEKFTTERYFRPNT
RCSITWFLSWSPCGECSRAITEFLSRHPYVTLF

APOBEC_N

• PFAM accession number: PF08210
• Interpro abstract (IPR013158):

  This domain is found at the N terminus of the Apolipoprotein B mRNA editing enzyme. Apobec-1 catalyzes C to U editing of apolipoprotein B (apoB) mRNA in the mammalian intestine.

  The N-terminal domain of APOBEC-1 like proteins is the catalytic domain, while the C-terminal domain is a pseudocatalyitc domain. More specifically, the catalytic domain is a zinc dependent deaminases domain and is essential for cytidine deamination. APOBEC-3 like members contain two copies of this domain. This family also includes the functionally homologous activation induced deaminase, which is essential for the development of antibody diversity in B lymphocytes. RNA editing by APOBEC-1 requires homodimerisation and this complex interacts with RNA binding proteins to from the editosome [ (PUBMED:12683974) ] (and references therein).

• GO function: zinc ion binding (GO:0008270), hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines (GO:0016814)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry APOBEC_N