The domain within your query sequence starts at position 28 and ends at position 121; the E-value for the APOC4 domain shown below is 9.6e-56.
MSTESLSPTPGPESSRWSLVRARVLEMVEPLVTRTRDRWQWFWGPGAVQGFMQTYYEDHL KDLGPRTQAWLQSSRDHLLNKTHSLCPRLLCKDR
APOC4 |
 |
|---|
| PFAM accession number: | PF15119 |
|---|---|
| Interpro abstract (IPR028120): | Apolipoprotein C-IV, also known as apolipoprotein C4, may play a role in lipid metabolism [ (PUBMED:10996355) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry APOC4