The domain within your query sequence starts at position 600 and ends at position 651; the E-value for the APP_amyloid domain shown below is 9.4e-25.
IVLSLLLLRKKKPYGTISHGVVEVDPMLTLEEQQLRELQRHGYENPTYRFLE
APP_amyloid |
---|
PFAM accession number: | PF10515 |
---|---|
Interpro abstract (IPR019543): | This is the amyloid, C-terminal, protein of the beta-Amyloid precursor protein (APP) which is a conserved and ubiquitous transmembrane glycoprotein strongly implicated in the pathogenesis of Alzheimer's disease but whose normal biological function is unknown. The C-terminal 100 residues are released and aggregate into amyloid deposits which are strongly implicated in the pathology of Alzheimer's disease plaque-formation. The domain is associated with IPR008154 further towards the N terminus. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry APP_amyloid