SMART: Pfam domain APP

The domain within your query sequence starts at position 600 and ends at position 651; the E-value for the APP_amyloid domain shown below is 9.4e-25.

IVLSLLLLRKKKPYGTISHGVVEVDPMLTLEEQQLRELQRHGYENPTYRFLE

APP_amyloid

PFAM accession number:	PF10515
Interpro abstract (IPR019543):	This is the amyloid, C-terminal, protein of the beta-Amyloid precursor protein (APP) which is a conserved and ubiquitous transmembrane glycoprotein strongly implicated in the pathogenesis of Alzheimer's disease but whose normal biological function is unknown. The C-terminal 100 residues are released and aggregate into amyloid deposits which are strongly implicated in the pathology of Alzheimer's disease plaque-formation. The domain is associated with IPR008154 further towards the N terminus.

PFAM accession number:

PF10515

Interpro abstract (IPR019543):

This is the amyloid, C-terminal, protein of the beta-Amyloid precursor protein (APP) which is a conserved and ubiquitous transmembrane glycoprotein strongly implicated in the pathogenesis of Alzheimer's disease but whose normal biological function is unknown. The C-terminal 100 residues are released and aggregate into amyloid deposits which are strongly implicated in the pathology of Alzheimer's disease plaque-formation. The domain is associated with IPR008154 further towards the N terminus.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry APP_amyloid