The domain within your query sequence starts at position 37 and ends at position 96; the E-value for the ARA70 domain shown below is 1.1e-17.
AEQQIKDNLREVKAQIHSCISRHLECLRSREVWLNEQVDLIYQLKEETLQQQAQQLYWVS
ARA70 |
![]() |
---|
PFAM accession number: | PF12489 |
---|---|
Interpro abstract (IPR022174): | This domain is found in eukaryotes, and is typically between 127 and 138 amino acids in length. It is found in ARA70, a nuclear coactivator which interacts with peroxisome proliferator-activated receptor gamma (PPARgamma) to regulate transcription, and the addition of the PPARgamma ligand (prostaglandin J2) enhances this interaction [ (PUBMED:10347167) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ARA70