The domain within your query sequence starts at position 138 and ends at position 214; the E-value for the ARL6IP6 domain shown below is 3e-32.
ENLKNEDDIHTGLLGFWSLLIISLTAGLSCCSFSWTVTYFDSFEPGMFPPTPLSPARFKK LTGHSFHMGYSMAILNG
ARL6IP6 |
![]() |
---|
PFAM accession number: | PF15062 |
---|---|
Interpro abstract (IPR029383): | ADP-ribosylation factor-like protein 6-interacting protein 6 (ARL6IP6) is a transmembrane helix present in the J2E erythro-leukaemic cell line, but not its myeloid variants. In tissues, ARL-6 mRNA was most abundant in brain and kidney. While ARL-6 protein was predominantly cytosolic, it is known to bind to SEC61-beta subunit of a protein conducting channel SEC61p [ (PUBMED:10508919) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ARL6IP6