The domain within your query sequence starts at position 1 and ends at position 154; the E-value for the ASF1_hist_chap domain shown below is 1.2e-74.

MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALSDDLEWKIIYVGSAESEEFDQILDSV
LVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYPDP
ELRENPPPKPDFSQLQRNILASNPRVTRFHINWD

ASF1_hist_chap

ASF1_hist_chap
PFAM accession number:PF04729
Interpro abstract (IPR006818):

This family includes the yeast and human ASF1 protein. These proteins have histone chaperone activity [ (PUBMED:14680630) ]. ASF1 participates in both the replication-dependent and replication-independent pathways. The structure three-dimensional has been determined as a compact immunoglobulin-like beta sandwich fold topped by three helical linkers [ (PUBMED:10759893) ].

GO process:chromatin assembly or disassembly (GO:0006333)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ASF1_hist_chap