SMART: Pfam domain ATAD4

The domain within your query sequence starts at position 6 and ends at position 87; the E-value for the ATAD4 domain shown below is 1.3e-26.

WWKLTFLRKKKSTPKVLYEIPDTYAQTEGGAEPPGPDAGDPHSDFNSRLEKIVDKNTKGK
HVKVSNSGRFKEKKKVRAMLAE

ATAD4

PFAM accession number:	PF15321
Interpro abstract (IPR028237):	This is a family of proteins found in eukaryotes that consists of proline-rich 15 (PRR15) and proline-rich 15-like proteins. PRR15 is expressed almost exclusively in post-mitotic cells both during foetal development and in adult tissues, such as the intestinal epithelium and the testis. Its expression in mouse and human gastrointestinal tumours is linked, directly or indirectly, to the disruption of the Wnt signaling pathway [ (PUBMED:21061267) ].

PFAM accession number:

PF15321

Interpro abstract (IPR028237):

This is a family of proteins found in eukaryotes that consists of proline-rich 15 (PRR15) and proline-rich 15-like proteins. PRR15 is expressed almost exclusively in post-mitotic cells both during foetal development and in adult tissues, such as the intestinal epithelium and the testis. Its expression in mouse and human gastrointestinal tumours is linked, directly or indirectly, to the disruption of the Wnt signaling pathway [ (PUBMED:21061267) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATAD4