The domain within your query sequence starts at position 77 and ends at position 195; the E-value for the ATG13 domain shown below is 1.5e-10.
GRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTP AYRLSRKQGHEYVILYRIYFGEVQLNGLGEGFQTVRVGTVGTPVGTLTLSCAYRINLAF
ATG13 |
![]() |
---|
PFAM accession number: | PF10033 |
---|---|
Interpro abstract (IPR018731): | This entry represents the N-terminal domain of autophagy-related protein 13 (Atg13) from yeasts, animals and plants. They function in autophagy. Fission yeast autophagy initiation is controlled by the Atg1 kinase complex, which is composed of the Ser/Thr kinase Atg1, the adaptor protein Atg13, and the ternary complex of Atg17-Atg31-Atg29. Atg13 recruits Atg1 to the site of autophagosome formation and enhancing Atg1 kinase activity. Atg13 may have additional functions that are independent of a direct interaction or permanent colocalization with Atg1 [ (PUBMED:24879146) ]. In vertebrates, the orthologous ULK1 kinase complex contains the Ser/Thr kinase ULK1 and the accessory proteins ATG13, RB1CC1, and ATG101 [ (PUBMED:24879146) ]. Through its regulation of ULK1 activity, Atg13 plays a role in the regulation of the kinase activity of mTORC1 and cell proliferation [ (PUBMED:19225151) ]. |
GO process: | autophagy (GO:0006914) |
GO component: | Atg1/ULK1 kinase complex (GO:1990316) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATG13