The domain within your query sequence starts at position 99 and ends at position 221; the E-value for the ATP-synt_ab_Xtn domain shown below is 3.3e-46.
FDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWEFIPSKNLRVGSHITGGDIYGIVNE NSLIKHKIMLPPRNRGSVTYIAPPGNYDASDVVLELEFEGVKEKFSMVQVWPVRQVRPVT EKL
ATP-synt_ab_Xtn |
![]() |
---|
PFAM accession number: | PF16886 |
---|---|
Interpro abstract (IPR031686): | This domain represents an extension domain at the N-terminal end of the alpha/beta catalytic subunit of some V-type proton ATPases. It is found from bacteria to humans. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP-synt_ab_Xtn