The domain within your query sequence starts at position 53 and ends at position 250; the E-value for the ATP_bind_3 domain shown below is 2.9e-19.
VVAVGASGGKDSTVLAHVLRELAPRLGITLHLVAVDEGIGGYRDAALEAVRSQAARWELP LTIVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLRRRALEEGARLVGATHIVTGHN ADDMAETVLMNFLRGDAGRLARGGVLGSTGEGCALPRCRPLQFASQKEVVLYAHFRHLRY FSEECVYAPEAFRGHARD
ATP_bind_3 |
![]() |
---|
PFAM accession number: | PF01171 |
---|---|
Interpro abstract (IPR011063): | The structure of tRNA(Ile)-lysidine synthetase consists of an N-terminal dinucleotide-binding fold domain (NTD), and a C-terminal globular domain (CTD). The structure of the NTD closely resembles that of a P-loop "N-type" ATP pyrophosphatase [ (PUBMED:15894617) ]. tRNA(Ile)-lysidine and 2-thiocytidine synthase both belong to the PP-loop superfamily [ (PUBMED:7731953) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP_bind_3