The domain within your query sequence starts at position 9 and ends at position 52; the E-value for the ATP_synt_H domain shown below is 4e-12.

PVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLLC

ATP_synt_H

• PFAM accession number: PF05493
• Interpro abstract (IPR008389):

  V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release [ (PUBMED:15629643) ]. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins [ (PUBMED:15907459) ].

  Transmembrane ATPases are membrane-bound enzyme complexes/ion transporters that use ATP hydrolysis to drive the transport of protons across a membrane. Some transmembrane ATPases also work in reverse, harnessing the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP.

  There are several different types of transmembrane ATPases, which can differ in function (ATP hydrolysis and/or synthesis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [ (PUBMED:15473999) (PUBMED:15078220) ]. The different types include:

  • F-ATPases (ATP synthases, F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts).
  • V-ATPases (V1V0-ATPases), which are primarily found in eukaryotes and they function as proton pumps that acidify intracellular compartments and, in some cases, transport protons across the plasma membrane [ (PUBMED:20450191) ]. They are also found in bacteria [ (PUBMED:9741106) ].
  • A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases, though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases [ (PUBMED:18937357) (PUBMED:1385979) ].
  • P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes.
  • E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.

  This entry represents subunit e (or subunit M9.2) found in the V0 complex of certain V-ATPases. The V0 complex contains subunit c (proton-conducting pore), as well as accessory subunits that function in assembly, targeting or regulation of the V-ATPase complex. Subunit e is an extremely hydrophobic protein of approximately 9kDa, which may be required for assembly of vacuolar ATPases [ (PUBMED:9556572) ]. The amino terminal domain of subunit E interacts with the H subunit and is required fo V-ATPase function [ (PUBMED:12163484) ]. Different isoforms of this subunit exist sometimes annotated as e1 and e2 also a neuron-specific isoform, NM9.2 has been identified [ (PUBMED:12544825) ].

• GO process: proton transmembrane transport (GO:1902600)
• GO component: proton-transporting V-type ATPase, V0 domain (GO:0033179)
• GO function: proton transmembrane transporter activity (GO:0015078)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP_synt_H