SMART: Pfam domain AXE1

The domain within your query sequence starts at position 163 and ends at position 229; the E-value for the AXE1 domain shown below is 3.7e-8.

EGLYLDSEAVLDYVMTRPDLDKTKVFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSI
PHMASTL

AXE1

PFAM accession number:	PF05448
Interpro abstract (IPR008391):	This domain can be found in several bacterial acetyl xylan esterase proteins. Acetyl xylan esterases are enzymes that hydrolyse the ester linkages of the acetyl groups in position 2 and/or 3 of the xylose moieties of natural acetylated xylan from hardwood. These enzymes are one of the accessory enzymes which are part of the xylanolytic system, together with xylanases, beta-xylosidases, alpha-arabinofuranosidases and methylglucuronidases; these are all required for the complete hydrolysis of xylan [ (PUBMED:10878123) ].

PFAM accession number:

PF05448

Interpro abstract (IPR008391):

This domain can be found in several bacterial acetyl xylan esterase proteins. Acetyl xylan esterases are enzymes that hydrolyse the ester linkages of the acetyl groups in position 2 and/or 3 of the xylose moieties of natural acetylated xylan from hardwood. These enzymes are one of the accessory enzymes which are part of the xylanolytic system, together with xylanases, beta-xylosidases, alpha-arabinofuranosidases and methylglucuronidases; these are all required for the complete hydrolysis of xylan [ (PUBMED:10878123) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AXE1