The domain within your query sequence starts at position 27 and ends at position 81; the E-value for the AZUL domain shown below is 1.7e-21.

AKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLC

AZUL

 AZUL
PFAM accession number:PF16558
Interpro abstract (IPR032353):

The AZUL or amino-terminal zinc-binding domain of ubiquitin E3a ligase (Ube3A) is found in eukaryotes, and is an unusual zinc-finger domain. The final cysteine is usually mutated in Angelman syndrome patients. It is likely that AZUL plays a role in Ube3A substrate-recognition [ (PUBMED:21947926) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AZUL