SMART: Pfam domain Aa

The domain within your query sequence starts at position 4 and ends at position 398; the E-value for the Aa_trans domain shown below is 1.5e-54.

ASTSKWGLITNVVNSIVGVSVLTMPFCFKQCGIVLGALLLVFCSWMTHQSCMFLVKSASL
SKRRTYAGLAFHAYGKAGKMLVETSMIGLMLGSCITFYVVIGDLGSNFFAPLLGLQVTRT
VRVFLLFAVSLFIVLPLSLQRNMMASIQSFSAMALLFYTVFMFVIVLSSLKHGLFSGQWL
RQVSYIRWEGVFRCVPIFGMSFACQSQVLPTYDSLDEPSVKTMSSIFASSLNVVTAFYVM
VGFFGYVSFTDATTGNVLIHFPSNPVTEMIRVGFVMSVAVGFPMMILPCRQALNTLLFEQ
QQKDGTFAAGGYMPPLRFKVLTLSVVFGTMVGGVMIPNVETILGFTGATMGSLICFICPA
LIYKKAHKNAPSAQVVLWVGLGILVVSTLTTLSVT

Aa_trans

PFAM accession number:	PF01490
Interpro abstract (IPR013057):	This transmembrane domain is found in many amino acid transporters including P34579 (UNC-47) and P40501 (MTR). UNC-47 encodes a vesicular amino butyric acid (GABA) transporter, (VGAT) and is is predicted to have 10 transmembrane domains UNC47_CAEEL [ (PUBMED:9349821) ]. MTR is an N system amino acid transporter system protein involved in methyltryptophan resistance MTR_NEUCR. Other proteins with this domain include proline transporters and amino acid transporters whose specificity has not yet been identified.

PFAM accession number:

PF01490

Interpro abstract (IPR013057):

This transmembrane domain is found in many amino acid transporters including P34579 (UNC-47) and P40501 (MTR). UNC-47 encodes a vesicular amino butyric acid (GABA) transporter, (VGAT) and is is predicted to have 10 transmembrane domains UNC47_CAEEL [ (PUBMED:9349821) ]. MTR is an N system amino acid transporter system protein involved in methyltryptophan resistance MTR_NEUCR. Other proteins with this domain include proline transporters and amino acid transporters whose specificity has not yet been identified.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Aa_trans