SMART: Pfam domain AbLIM

The domain within your query sequence starts at position 12 and ends at position 164; the E-value for the AbLIM_anchor domain shown below is 4.3e-55.

TRTSSESIVSVPASSTSGSPSRVIYAKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSP
YISHSAVGDRQSYGEGDQDDRSYKQCRTSSPSSAGSVSLGHYTPTSRSPQHYSRPGPVAQ
SPMSKLSGLVSVLSLVVQEAGRSKRWAGLSPPQ

AbLIM_anchor

PFAM accession number:	PF16182
Interpro abstract (IPR032402):	This is a domain lying between the LIM actin-binding and the vilin-head domains of actin-binding LIM proteins (abLIMs). It is likely that this domain is involved in anchoring abLIMs to circumferential actin bundles in specific cell types [ (PUBMED:20709423) ]. It is also found in Dematin, an actin-binding protein originally identified in the junctional complex of the erythrocyte plasma membrane [ (PUBMED:19241372) ].

PFAM accession number:

PF16182

Interpro abstract (IPR032402):

This is a domain lying between the LIM actin-binding and the vilin-head domains of actin-binding LIM proteins (abLIMs). It is likely that this domain is involved in anchoring abLIMs to circumferential actin bundles in specific cell types [ (PUBMED:20709423) ]. It is also found in Dematin, an actin-binding protein originally identified in the junctional complex of the erythrocyte plasma membrane [ (PUBMED:19241372) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AbLIM_anchor