The domain within your query sequence starts at position 39 and ends at position 101; the E-value for the Abhydro_lipase domain shown below is 2.8e-26.
QSELISYWGYPYEKHDVITEDGYILGTYRIPHGKGCSRKTAPKAVVYLQHGLIASANNWI CNL
Abhydro_lipase |
![]() |
---|
PFAM accession number: | PF04083 |
---|---|
Interpro abstract (IPR006693): | The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function. The core of each enzyme is similar: an alpha/beta sheet, not barrel, of eight beta-sheets connected by alpha-helices [ (PUBMED:1409539) ]. This entry represents the N-terminal part of an alpha/beta hydrolase domain found in a number of lipases. |
GO process: | lipid metabolic process (GO:0006629) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Abhydro_lipase