The domain within your query sequence starts at position 306 and ends at position 455; the E-value for the Acyl-CoA_dh_1 domain shown below is 6.7e-41.

GDGFKVAVNILNNGRFGMAATLAGTMKSLIAKAVDHATNRTQFGDKIHNFGVIQEKLARM
AILQYVTESMAYMLSANMDQGFKDFQIEAAISKIFCSEAAWKVADECIQIMGGMGFMKEP
GVERVLRDIRIFRIFEGANDILRLFVALQG

Acyl-CoA_dh_1

 Acyl-CoA_dh_1
PFAM accession number:PF00441
Interpro abstract (IPR009075):

Acyl-CoA dehydrogenases ( EC 1.3.99.3 ) are a family of flavoproteins that catalyse the alpha,beta-dehydrogenation of acyl-CoA thioesters to the corresponding trans 2,3-enoyl CoA-products with the concomitant reduction of enzyme-bound FAD. Different family members share a high sequence identity, catalytic mechanisms, and structural properties, but differ in the position of their catalytic bases and in their substrate binding specificity. Butyryl-CoA dehydrogenase [ (PUBMED:11812788) ] prefers short chain substrates, medium chain- and long-chain acyl-CoA dehydrogenases prefer medium and long chain substrates, respectively, and Isovaleryl-CoA dehydrogenase [ (PUBMED:9214289) ] prefers branched-chain substrates.

The monomeric enzyme is folded into three domains of approximately equal size, where the N-terminal domain is all-alpha, the middle domain is an open [ (PUBMED:14728676) (PUBMED:14728675) ] barrel, and the C-terminal domain is a four-helical bundle. This entry represents the C-terminal domain found in medium chain acyl-CoA dehydrogenases, as well as in the related peroxisomal acyl-CoA oxidase-II enzymes, where this domain occurs as a tandem duplication. Acyl-CoA oxidase (ACO; EC 1.3.3.6 ) catalyzes the first and rate-determining step of the peroxisomal beta-oxidation of fatty acids [ (PUBMED:11872165) ].

GO process:oxidation-reduction process (GO:0055114)
GO function:oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Acyl-CoA_dh_1