The domain within your query sequence starts at position 261 and ends at position 510; the E-value for the Adap_comp_sub domain shown below is 6.8e-38.

ATKVHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKFGRIRLHVENE
DKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTINC
WPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAPVIGEIDGEYRHDSRRNTLEW
CLPVIDAKNKSGSLEFSIPGQPNDFFPVQVSFISKKNYCNIQVTKVTQVDGNSPVRFSTE
TTFLVDKYEI

Adap_comp_sub

 Adap_comp_sub
PFAM accession number:PF00928
Interpro abstract (IPR028565):

The mu homology domain (MHD) is an ~280 residue protein-protein interaction module, which is found in endocytotic proteins involved in clathrin-mediated endocytosis [ (PUBMED:11381094) (PUBMED:11454741) (PUBMED:14726597) (PUBMED:19713939) ]:

  • Mu subunits of adaptor protein (AP) complexes, AP-1, AP-2, AP-3, and AP-4.
  • Proteins of the stonin family.
  • Proteins of the muniscin family: Syp1, FCHO1/2 and SGIP1.

The MHD domain has an elongated, banana-shaped, all beta-sheet structure. It can be considered as two beta-sandwich subdomains (A and B), with subdomain B inserted between strands 6 and 15 of subdomain A, and joined edge to edge such that the convex surface is a continuous nine-stranded mixed beta-sheet that runs the whole length of the molecule. The tyrosine based signal binds to a site on the surface of two parallel beta-sheet strands (beta1 and beta16) in subdomain A [ (PUBMED:19713939) (PUBMED:9812899) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Adap_comp_sub