The domain within your query sequence starts at position 401 and ends at position 501; the E-value for the AdenylateSensor domain shown below is 6.4e-18.
KWHLGIRSQSKACDIMAEVYRAMKQLGFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLV DSRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRARSS
AdenylateSensor |
![]() |
---|
PFAM accession number: | PF16579 |
---|---|
Interpro abstract (IPR032270): | This domain can be found at the C terminus of yeast SNF1 and animal 5'-AMP (adenosine monophosphate)-activated protein kinase (AMPK) subunit alpha [ (PUBMED:17289942) ]. The yeast SNF1 kinase is a prototype of AMPKs that regulate cellular responses to a variety of nutritional and environmental stresses [ (PUBMED:9759505) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AdenylateSensor