The domain within your query sequence starts at position 252 and ends at position 363; the E-value for the AdoMet_MTase domain shown below is 3.1e-42.
LVSILRYSRMYQELKEKYRDMVKVWPEVTDPEKFVYEDVAIATYLLILWEEERAEKGVTT KQSFVDLGCGNGLLVHILSNEGHPGRGIDIRRRKIWDMYGPQTQLEEGSITP
AdoMet_MTase |
 |
|---|
| PFAM accession number: | PF07757 |
|---|---|
| Interpro abstract (IPR011671): | tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [ (PUBMED:18025252) ]. |
| GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AdoMet_MTase