The domain within your query sequence starts at position 53 and ends at position 166; the E-value for the AhpC-TSA_2 domain shown below is 9.9e-25.
DLSNLRSILDQHDVRLVGVGPEALGLQEFLDGGYFSGELYLDESKQIYKELGFKRYNSLS ILPAALGKPVRDVASKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFIQKS
AhpC-TSA_2 |
![]() |
---|
PFAM accession number: | PF13911 |
---|---|
Interpro abstract (IPR032801): | This family consists of proteins from the peroxiredoxin-like family, including PRXL2A, PXL2B (also known as prostamide/prostaglandin F synthase) [ (PUBMED:18006499) ] and PXL2C (also known as AAED1). PRXL2A is a secreted redox regulatory protein with potent anti-inflammatory properties [ (PUBMED:26438880) ]. PXL2C regulates proliferation and glycolysis in gastric cancer [ (PUBMED:29901208) ]. |
GO process: | oxidation-reduction process (GO:0055114) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AhpC-TSA_2