The domain within your query sequence starts at position 155 and ends at position 300; the E-value for the Aida_C2 domain shown below is 2.4e-68.
LLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKED TYVHFNVDIELQKHVERLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIEL YKKPTDFKRKKLQLLTKKPLYLHLHQ
Aida_C2 |
![]() |
---|
PFAM accession number: | PF14186 |
---|---|
Interpro abstract (IPR025939): | This domain is found at the C terminus of axin interaction dorsal-associated (AIDA) proteins, and is a distinct version of the C2 domain. This domain is critical for interactions with cytoskeletal in the context of cellular adhesion points [ (PUBMED:20713135) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Aida_C2