The domain within your query sequence starts at position 224 and ends at position 359; the E-value for the AlbA_2 domain shown below is 2.1e-30.
ETRNMEFKRGSGEYLSLAFKHHVRRYVCAFLNSEGGSLLVGVEDSGLVQGIHCSHRDEDR TRLLVDSILQGFKPQVFPDAYTLTFIPVISTTTTSTPLKVLRLTVHTPKAQGEPQLYETD QGEVFLRRDGSIQGPL
AlbA_2 |
---|
PFAM accession number: | PF04326 |
---|---|
Interpro abstract (IPR007421): | This entry represents the AlbA clan of DNA-binding domains. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AlbA_2