The domain within your query sequence starts at position 148 and ends at position 360; the E-value for the Alpha-2-MRAP_C domain shown below is 3.4e-73.
ELGDPRLEKLWHKAKTSGKFSSEELDKLWREFLHYKEKIQEYNVLLDTLSRAEEGYENLL SPSDMAHIKSDTLISKHSELKDRLRSINQGLDRLRKVSHQGYGSTTEFEEPRVIDLWDLA QSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKY VLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Alpha-2-MRAP_C |
---|
PFAM accession number: | PF06401 |
---|---|
Interpro abstract (IPR010483): | The alpha-2-macroglobulin receptor-associated protein (RAP) is a intracellular glycoprotein that binds to the 2-macroglobulin receptor and other members of the low density lipoprotein receptor family. The protein inhibits binding of all currently known ligands of these receptors [ (PUBMED:9207124) ]. Two different studies have provided conflicting domain boundaries. |
GO component: | endoplasmic reticulum (GO:0005783) |
GO function: | low-density lipoprotein particle receptor binding (GO:0050750), heparin binding (GO:0008201) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Alpha-2-MRAP_C