The domain within your query sequence starts at position 3 and ends at position 93; the E-value for the Aminotran_3 domain shown below is 1.3e-19.

RKWPLSLAGYNHPALAKLVQQPQNASTFINRPALGILPPENFVDKLQESLMSVAPRGMSQ
LITMACGSCSNENAFKTIFMWYRVSYGAGAP

Aminotran_3

Aminotran_3
PFAM accession number:PF00202
Interpro abstract (IPR005814):

Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue. On the basis of sequence similarity, these various enzymes can be grouped [ (PUBMED:1618757) ] into subfamilies. One of these, called class-III, includes acetylornithine aminotransferase ( EC 2.6.1.11 ), which catalyzes the transfer of an amino group from acetylornithine to alpha-ketoglutarate, yielding N-acetyl-glutamic-5-semi-aldehyde and glutamic acid [ (PUBMED:2199330) ]; ornithine aminotransferase ( EC 2.6.1.13 ), which catalyzes the transfer of an amino group from ornithine to alpha-ketoglutarate, yielding glutamic-5-semi-aldehyde and glutamic acid [ (PUBMED:3754226) ]; omega-amino acid--pyruvate aminotransferase ( EC 2.6.1.18 ), which catalyzes transamination between a variety of omega-amino acids, mono- and diamines, and pyruvate [ (PUBMED:2500426) ]; 4-aminobutyrate aminotransferase ( EC 2.6.1.19 ) (GABA transaminase), which catalyzes the transfer of an amino group from GABA to alpha-ketoglutarate, yielding succinate semialdehyde and glutamic acid [ (PUBMED:10989446) ]; DAPA aminotransferase ( EC 2.6.1.62 ), a bacterial enzyme (bioA), which catalyzes an intermediate step in the biosynthesis of biotin, the transamination of 7-keto-8-aminopelargonic acid to form 7,8-diaminopelargonic acid [ (PUBMED:1092681) ]; 2,2-dialkylglycine decarboxylase ( EC 4.1.1.64 ), a Burkholderia cepacia (Pseudomonas cepacia) enzyme (dgdA) that catalyzes the decarboxylating amino transfer of 2,2-dialkylglycine and pyruvate to dialkyl ketone, alanine and carbon dioxide [ (PUBMED:8342040) ]; glutamate-1-semialdehyde aminotransferase ( EC 5.4.3.8 ) (GSA) [ (PUBMED:2349227) ]; Bacillus subtilis aminotransferases yhxA and yodT; Haemophilus influenzae diaminobutyrate--2-oxoglutarate aminotransferase (HI0949) [ (PUBMED:9514614) ]; and Caenorhabditis elegans alanine--glyoxylate aminotransferase 2-like (T01B11.2).

GO function:pyridoxal phosphate binding (GO:0030170), transaminase activity (GO:0008483)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Aminotran_3