SMART: Pfam domain Aminotran

The domain within your query sequence starts at position 124 and ends at position 424; the E-value for the Aminotran_MocR domain shown below is 7.6e-9.

AFEMLINPGDTILVNEPLFPGTLYAMKPLGCNIINVPSDEHGIIPEGLKKILSQWKPEDS
KDPTKKTPKFLYTVPNGNNPTGNSLTGDRKKEIYELARKYDFLIIEDDPYYFLQFSKPWE
PTFLSMDVDGRVIRADTFSKTVSSGLRVGFMTGPKTLIQNIVLHTQVSSVHACTLSQLMI
LQLLHQWGEEGFLAHIDRTIDFYKNQRDSILAAADKWLRGLAEWHVPKAGMFLWIKVKGI
SDTKQLIEEKAIEREVLLVPGNGFFIDGSAPTSFFRASFSLATPAQMDTAFQRLAQLIKE
S

Aminotran_MocR

PFAM accession number:	PF12897
Interpro abstract (IPR024551):	Aminotransferases (ATs) are pyridoxal phosphate (PLP)-dependent enzymes that catalyze the reversible transfer of nitrogen from an amino donor to a keto acid amino acceptor. ATs have been classified into five classes by evolutionary relationship. Aspartate aminotransferase (AspAT) belongs to class I ATs. AspAT catalyzes the reaction from L-glutamate and oxaloacetate to L-aspartate and alpha-ketoglutarate [ (PUBMED:8513804) ]. This entry represents a subgroup (Ic) of aspartate aminotransferases (AspATs) from bacteria. They contain an unique auxiliary N-terminal domain absence in humans. Proteins in this entry include aspartate aminotransferase Rv3722c from Mycobacterium tuberculosis [ (PUBMED:32327655) ] and AspT from Corynebacterium glutamicum [ (PUBMED:27355211) ].
GO function:	L-aspartate:2-oxoglutarate aminotransferase activity (GO:0004069)

PFAM accession number:

PF12897

Interpro abstract (IPR024551):

Aminotransferases (ATs) are pyridoxal phosphate (PLP)-dependent enzymes that catalyze the reversible transfer of nitrogen from an amino donor to a keto acid amino acceptor. ATs have been classified into five classes by evolutionary relationship. Aspartate aminotransferase (AspAT) belongs to class I ATs. AspAT catalyzes the reaction from L-glutamate and oxaloacetate to L-aspartate and alpha-ketoglutarate [ (PUBMED:8513804) ].

This entry represents a subgroup (Ic) of aspartate aminotransferases (AspATs) from bacteria. They contain an unique auxiliary N-terminal domain absence in humans. Proteins in this entry include aspartate aminotransferase Rv3722c from Mycobacterium tuberculosis [ (PUBMED:32327655) ] and AspT from Corynebacterium glutamicum [ (PUBMED:27355211) ].

GO function:

L-aspartate:2-oxoglutarate aminotransferase activity (GO:0004069)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Aminotran_MocR