The domain within your query sequence starts at position 530 and ends at position 738; the E-value for the Angiomotin_C domain shown below is 5.2e-95.
YVEKVEKLQQALTQLQSACEKRGQMERRLRTWLERELDALRTQQKHGTGPPVSLPECNAP ALMELVREKEERILALEADMTKWEQKYLEESTIRHFAMSAAAAATAERDTTISNHSRNGS YGESSLEAHIWPEEEEVVQANRRCQDMEYTIKNLHAKIIEKDAMIKVLQQRSRKDAGKTD SASLRPARSVPSIAAATGTHSRQTSLTSS
Angiomotin_C |
![]() |
---|
PFAM accession number: | PF12240 |
---|---|
Interpro abstract (IPR024646): | This domain represents the C-terminal region of angiomotin. Angiomotin regulates the action of angiogenesis-inhibitor angiostatin [ (PUBMED:11257124) ]. The C-terminal region of angiomotin appears to be involved in directing the protein chemotactically [ (PUBMED:12902404) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Angiomotin_C