The domain within your query sequence starts at position 141 and ends at position 227; the E-value for the Anillin_N domain shown below is 5e-34.

VKTRMQRLAEQRRHWDSDLTDDVSESSYFAPVPTEDKAASPSKPPISNASATPVGRRGRL
ANLAATICSWEDDVSHSSAKQNSVQEQ

Anillin_N

Anillin_N
PFAM accession number:PF16018
Interpro abstract (IPR031970):

This domain is found towards the N terminus of anillin (ANLN), a F-actin-binding protein with important roles in cell cytokinesis [ (PUBMED:20732437) (PUBMED:24676636) ]. In mammalian anillin, this domain is repeated. This domain overlaps with the region responsible for nuclear localisation of anillin [ (PUBMED:10931866) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Anillin_N