The domain within your query sequence starts at position 49 and ends at position 274; the E-value for the Anoct_dimer domain shown below is 2.2e-63.
SSAKPPIDFVLVWEEDLRNQENPTKDKTDTHEVWRETFLENLCLAGLKIDQHDVQDEAAA VHYILLRAPWAVLCYYAEDLRLKLPLQELPNQASNWSATLLEWLGIPNILLEHVPDTPPE YYSCQFKASKLQWFLGSDNQDTFFTSTKRHQILFEILAKTPYGHEKKGLFGIDQLLAEGV FSAAFPLHDGPFSAVPESSQVLGLIQRQVLFQHWARWGKWNKYQPL
Anoct_dimer |
![]() |
---|
PFAM accession number: | PF16178 |
---|---|
Interpro abstract (IPR032394): | This appears to be the cytoplasmic domain of the calcium-activated chloride-channel anoctamin [ (PUBMED:22946059) ]. It is responsible for creating the homodimeric architecture of the chloride-channel proteins [ (PUBMED:23576756) ]. |
GO function: | protein dimerization activity (GO:0046983) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Anoct_dimer