The domain within your query sequence starts at position 1 and ends at position 74; the E-value for the Apc13p domain shown below is 6.9e-23.
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLSELPEPEQDNGGTTESVKEQEMKWTDL ALQGLHENVPPAGN
Apc13p |
---|
PFAM accession number: | PF05839 |
---|---|
Interpro abstract (IPR008401): | The anaphase-promoting complex (APC) is a conserved multi-subunit ubiquitin ligase required for the degradation of key cell cycle regulators. Members of this family are components of the anaphase-promoting complex homologous to Apc13 [ (PUBMED:12477395) ]. |
GO component: | anaphase-promoting complex (GO:0005680) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Apc13p