The domain within your query sequence starts at position 1 and ends at position 74; the E-value for the Apc13p domain shown below is 6.9e-23.

MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLSELPEPEQDNGGTTESVKEQEMKWTDL
ALQGLHENVPPAGN

Apc13p

Apc13p
PFAM accession number:PF05839
Interpro abstract (IPR008401):

The anaphase-promoting complex (APC) is a conserved multi-subunit ubiquitin ligase required for the degradation of key cell cycle regulators. Members of this family are components of the anaphase-promoting complex homologous to Apc13 [ (PUBMED:12477395) ].

GO component:anaphase-promoting complex (GO:0005680)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Apc13p