The domain within your query sequence starts at position 21 and ends at position 97; the E-value for the Apo-CII domain shown below is 1.8e-42.
QGNQEDDSGSLALLGTVQGSLLSYWTSAKEVAKDLYQKTYPISMDEKLRDMYSKSSAAMS TYAGIFTDQLLTLLRGE
Apo-CII |
---|
PFAM accession number: | PF05355 |
---|---|
Interpro abstract (IPR008019): | Apolipoprotein CII (apoC-II) is a surface constituent of plasma lipoproteins and the activator for lipoprotein lipase (LPL). It is therefore central for lipid transport in blood. Lipoprotein lipase is a key enzyme in the regulation of triglyceride levels in human serum [ (PUBMED:10903476) ]. It is the C-terminal helix of apoC-II that is responsible for the activation of LPL [ (PUBMED:12590574) ]. The active peptide of apoC-II occurs at residues 44-79 and has been shown to reverse the symptoms of genetic apoC-II deficiency in a human subject [ (PUBMED:10903476) ]. Micellar SDS, a commonly used mimetic of the lipoprotein surface, inhibits the aggregation of apoC-II and induces a stable structure containing approximately 60% alpha-helix. The first 12 residues of apoC-II are structurally heterogeneous but the rest of the protein forms a predominantly helical structure [ (PUBMED:11331005) ]. |
GO process: | lipid metabolic process (GO:0006629), lipid transport (GO:0006869) |
GO component: | chylomicron (GO:0042627) |
GO function: | enzyme activator activity (GO:0008047) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Apo-CII