The domain within your query sequence starts at position 27 and ends at position 87; the E-value for the ApoC-I domain shown below is 3.2e-34.

APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTT
F

ApoC-I

ApoC-I
PFAM accession number:PF04691
Interpro abstract (IPR006781):

Exchangeable apolipoproteins are water-soluble protein components of lipoproteins that solubilise lipids and regulate their metabolism by binding to cell receptors or activating specific enzymes. Apolipoprotein C-I (ApoC-1) is the smallest exchangeable apolipoprotein and transfers among HDL (high density lipoprotein), VLDL (very low-density lipoprotein) and chlylomicrons. ApoC-1 activates lecithin:choline acetyltransferase (LCAT), inhibits cholesteryl ester transfer protein, can inhibit hepatic lipase and phospholipase 2 and can stimulate cell growth. ApoC-1 delays the clearance of beta-VLDL by inhibiting its uptake via the LDL receptor-related pathway [ (PUBMED:11580293) ]. ApoC-1 has been implicated in hypertriglyceridemia [ (PUBMED:11353333) ], and Alzheimer s disease [ (PUBMED:11741391) ].

ApoC-1 is believed to comprise of two dynamic helices that are stabilised by interhelical interactions and are connected by a short linker region. The minimal folding unit in the lipid-free state of this and other exchangeable apolipoproteins comprises the helix-turn-helix motif formed of four 11-mer sequence repeats.

GO process:lipoprotein metabolic process (GO:0042157)
GO component:extracellular region (GO:0005576)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ApoC-I