The domain within your query sequence starts at position 63 and ends at position 262; the E-value for the Apolipo_F domain shown below is 1.3e-94.
PLSCQMLLPKSLPGFTYMPPVSKFLVGLALRNALEAAGCQAEVWALQLQLYRLGGVEATQ ALIHHLQELQKSGHTDREVSVDALSSALQLLAWEQPGPKRAKRSISNTDCDNDQEQSVHN VVDLLPAVGTYYNLGTALYYAIKNCSDKAKERGRDGAIDLGYDLLMAMVGASGGPAGAVI TAALKPAMKAGVQRLIQYYY
Apolipo_F |
---|
PFAM accession number: | PF15148 |
---|---|
Interpro abstract (IPR026114): | Human apolipoprotein F (APOF) is a minor apolipoprotein that associates with LDL. It inhibits cholesteryl ester transfer protein (CETP) activity and appears to be an important regulator of cholesterol transport. It also associates to a lesser degree with VLDL, Apo-AI and Apo-AII [ (PUBMED:9880564) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Apolipo_F