The domain within your query sequence starts at position 61 and ends at position 146; the E-value for the Apolipoprotein domain shown below is 8.5e-31.
ALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNE VHTMLGQSTEEIRARLSTHLRKMRKR
Apolipoprotein |
![]() |
---|
PFAM accession number: | PF01442 |
---|---|
Interpro abstract (IPR000074): | Exchangeable apolipoproteins (apoA, apoC and apoE) have the same genomic structure and are members of a multi-gene family that probably evolved from a common ancestral gene. This entry includes the ApoA1, ApoA4, Apo5 and ApoE proteins. ApoA1, ApoA4 and Apo5 are part of the APOA1/C3/A4/A5 gene cluster on chromosome 11 [ (PUBMED:15108119) ]. Apolipoproteins function in lipid transport as structural components of lipoprotein particles, cofactors for enzymes and ligands for cell-surface receptors. In particular, apoA1 is the major protein component of high-density lipoproteins; apoA4 is thought to act primarily in intestinal lipid absorption; and apoE is a blood plasma protein that mediates the transport and uptake of cholesterol and lipid by way of its high affinity interaction with different cellular receptors, including the low-density lipoprotein (LDL) receptor. Recent findings with apoA1 and apoE suggest that the tertiary structures of these two members of the human exchangeable apolipoprotein gene family are related [ (PUBMED:15234552) ]. The three-dimensional structure of the LDL receptor-binding domain of apoE indicates that the protein forms an unusually elongated four-helix bundle that may be stabilised by a tightly packed hydrophobic core that includes leucine zipper-type interactions and by numerous salt bridges on the mostly charged surface. Basic amino acids important for LDL receptor binding are clustered into a surface patch on one long helix [ (PUBMED:2063194) ]. |
GO process: | lipoprotein metabolic process (GO:0042157), lipid transport (GO:0006869) |
GO component: | extracellular region (GO:0005576) |
GO function: | lipid binding (GO:0008289) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Apolipoprotein