SMART: Pfam domain ArgoL1

The domain within your query sequence starts at position 228 and ends at position 276; the E-value for the ArgoL1 domain shown below is 4.6e-8.

QIGRNYYNPSDPIDIPNHRLVIWPGFTTSILQYENNIMLCTDVSHKVLR

ArgoL1

PFAM accession number:	PF08699
Interpro abstract (IPR014811):	ArgoL1 is a region found in argonaute [ (PUBMED:16216572) ] proteins. It normally co-occurs with BAG domain ( IPR003103 ) and Piwi domain ( IPR003165 ). It is a linker region between the N-terminal and the PAZ domains. It contains an alpha-helix packed against a three-stranded antiparallel beta-sheet with two long beta-strands (beta8 and beta9) of the sheet spanning one face of the adjacent N and PAZ domains. L1 together with linker 2, L2, PAZ and ArgoN forms a compact global fold [ (PUBMED:16061186) ].

PFAM accession number:

PF08699

Interpro abstract (IPR014811):

ArgoL1 is a region found in argonaute [ (PUBMED:16216572) ] proteins. It normally co-occurs with BAG domain ( IPR003103 ) and Piwi domain ( IPR003165 ). It is a linker region between the N-terminal and the PAZ domains. It contains an alpha-helix packed against a three-stranded antiparallel beta-sheet with two long beta-strands (beta8 and beta9) of the sheet spanning one face of the adjacent N and PAZ domains. L1 together with linker 2, L2, PAZ and ArgoN forms a compact global fold [ (PUBMED:16061186) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ArgoL1