SMART: Pfam domain Arm

The domain within your query sequence starts at position 2094 and ends at position 2350; the E-value for the Arm_2 domain shown below is 2.6e-89.

CNCRCKRTVNLDPHDLEKLICMIEMTEDPSVHEIATNALYNSADYPYPQEIDRNIGGISV
IQSLLSNPYPNVRQKALNALNNISVAAENHRTVKTYLSQVCEDTVTYPLNSNVQVAGLRL
IKHLTITSEYQHMVTNYISEFLRLLALGSGETKDHVLGMLVNFSKNPSMTRDLLIANAPT
ALINIFSKKETKENILNALLLFENINRHFKKRGKTYPQDRFSKTSLYFLFQRPKACAKKL
RALAADCSDPEVKERVE

Arm_2

PFAM accession number:	PF04826
Interpro abstract (IPR006911):	This domain contains armadillo-like repeats [ (PUBMED:15034937) ]. Proteins containing this domain interact with numerous other proteins, through these interactions they are involved in a wide variety of processes including carcinogenesis [ (PUBMED:17904127) ], control of cellular ageing and survival [ (PUBMED:15034937) ], regulation of circadian rhythm [ (PUBMED:11597585) ] and lysosomal sorting of G protein-coupled receptors [ (PUBMED:12142540) ].

PFAM accession number:

PF04826

Interpro abstract (IPR006911):

This domain contains armadillo-like repeats [ (PUBMED:15034937) ]. Proteins containing this domain interact with numerous other proteins, through these interactions they are involved in a wide variety of processes including carcinogenesis [ (PUBMED:17904127) ], control of cellular ageing and survival [ (PUBMED:15034937) ], regulation of circadian rhythm [ (PUBMED:11597585) ] and lysosomal sorting of G protein-coupled receptors [ (PUBMED:12142540) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Arm_2