The domain within your query sequence starts at position 466 and ends at position 516; the E-value for the Arm_3 domain shown below is 6e-26.

NPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQ

Arm_3

Arm_3
PFAM accession number:PF16186
Interpro abstract (IPR032413):

This atypical Arm repeat appears at the very C terminus of eukaryotic proteins such as importin subunit alpha, as the last of the repeating units.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Arm_3