The domain within your query sequence starts at position 13 and ends at position 232; the E-value for the Ashwin domain shown below is 8.7e-84.
AELLLHPELLSQEFLLLTLEQKNIAVENEVRVNKDNLTDLYVQHAIPLPQRDLPKNRWGK MMEKKREHHEVKNDTKRSSAVDGLRKRPLIVFDGSSTSTSIKVKRTENGADDRLKPLAQI GSTSDAFWKSPNSSSRISPLVLFSNLPVNHKMEHNNNDTQQNHDLMNRKSPSGPVKSPPL SPVGTTPVKLKRAAPKEEAEATNHLKPPEVKRKIQHVTWP
Ashwin |
---|
PFAM accession number: | PF15323 |
---|---|
Interpro abstract (IPR024887): | Ashwin is a developmental protein that is expressed in the neural plate, and later in the embryonic brain, eyes, and spinal cord [ (PUBMED:16680723) ]. It may be involved in the regulation cell survival and anteroposterior patterning. Ashwin has been shown to form a complex with HSPC117, which is a catalytic subunit of the tRNA-splicing ligase complex [ (PUBMED:21311021) ]. |
GO process: | embryonic morphogenesis (GO:0048598) |
GO component: | tRNA-splicing ligase complex (GO:0072669) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ashwin