The domain within your query sequence starts at position 203 and ends at position 410; the E-value for the BAAT_C domain shown below is 3.1e-86.
MHMEYFEEAVNYLRSHPEVKGPGIGLLGISKGGELGLAMASFLKGITAAVVINGSVAAVG NTISYKDETIPPVTILRNQVKMTKDGLKDVVDALQSPLVDKKSFIPVERSDTTFLFLVGQ DDHNWKSEFYADEISKRLQAHGKEKPQIICYPAAGHYIEPPYFPLCSAGMHLLVGANITF GGEPKPHAMAQLDAWQQLQTFFHKQLGS
BAAT_C |
---|
PFAM accession number: | PF08840 |
---|---|
Interpro abstract (IPR014940): | Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Bile acid-CoA:amino acid N-acetyltransferase (BAAT) is involved in bile acid metabolism and may also act as an acyl-CoA thioesterase that regulates intracellular levels of free fatty acids [ (PUBMED:12810727) ]. This entry represents a catalytic domain is found at the C terminus of acyl-CoA thioester hydrolases and bile acid-CoA:amino acid N-acetyltransferases. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BAAT_C