The domain within your query sequence starts at position 23 and ends at position 276; the E-value for the BBS1 domain shown below is 2.7e-104.
WLDAHYDPMANIHTFSSCLSLADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPTVLTESPL PALPASAATFLMDQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQA KEDQIDPLTLKEMLEDIREKADVPLSVQSLRFLQLELSEMEAFVNQHKSKVIKRQTVITT MTTLKKNLADEDAASCLVLGTESKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFR LTAACRNGSIYILR
BBS1 |
![]() |
---|
PFAM accession number: | PF14779 |
---|---|
Interpro abstract (IPR032728): | This entry represents the N-terminal domain of the Bardet-Biedl syndrome 1 protein (BBS1). Bardet-Biedl syndrome is characterised by usually severe pigmentary retinopathy, early-onset obesity, polydactyly, hypogenitalism, renal malformation and mental retardation [ (PUBMED:12118255) ]. Bardet-Biedl syndrome proteins (BBS1, BBS2, BBS4, BBS5, BBS7, BBS8/TTC8, BBS9 and BBIP10) form the BBSome complex, which may function as a coat complex required for sorting of specific membrane proteins to the primary cilia [ (PUBMED:17574030) ]. The ciliary trafficking function of BBSome is regulated by LZTFL1 (Leucine-zipper transcription factor-like 1) [ (PUBMED:22072986) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BBS1