The domain within your query sequence starts at position 6 and ends at position 46; the E-value for the BCAS2 domain shown below is 9e-10.

LVAGEVVVDALPYFDQGYEAPGVREAVSAGHVRRVRRRHAA

BCAS2

BCAS2
PFAM accession number:PF05700
Interpro abstract (IPR008409):

Proteins in this family are involved in mRNA splicing [ (PUBMED:17575050) ]. This family includes pre-mRNA-splicing factor SPF27, SNT309 and Cwf7. In humans, SPF27 is a component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. It may have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex [ (PUBMED:20176811) ].

GO process:mRNA processing (GO:0006397)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BCAS2