SMART: Pfam domain BCNT

The domain within your query sequence starts at position 217 and ends at position 291; the E-value for the BCNT domain shown below is 5e-34.

ASGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDR
VDHRQFEIERDLRLS

BCNT

PFAM accession number:	PF07572
Interpro abstract (IPR011421):	Vertebrate BCNT (named after Bucentaur) protein is found in the nucleus and cytosol. Gene duplication of the ancestral BCNT gene leads to the h-type BCNT or craniofacial development protein 1 (CFDP1) gene and the ruminant-specific p97BCNT or craniofacial development protein 2 (CFDP2) gene. The h-type BCNT proteins contain a highly conserved 82-amino acid region at the C terminus (BCNT-C) that is not present in p97BCNT. Instead ruminant p97BCNT contains a region derived from the endonuclease domain of a retrotransposable element RTE-1 [ (PUBMED:12832649) (PUBMED:16384818) ]. In addition to h-type BCNT proteins, a BCNT-C domain is also found in Drosophila YETI, a protein that binds to a microtubule-based motor kinesin-1, and the yeast SWR1-complex protein 5 (SWC5) or AOR1 (actin overexpression resistant 1), a component of the SWR1 chromatin remodeling complex [ (PUBMED:16384818) (PUBMED:14720462) ]. The entry represents the entire BCNT-C domain.

PFAM accession number:

PF07572

Interpro abstract (IPR011421):

Vertebrate BCNT (named after Bucentaur) protein is found in the nucleus and cytosol. Gene duplication of the ancestral BCNT gene leads to the h-type BCNT or craniofacial development protein 1 (CFDP1) gene and the ruminant-specific p97BCNT or craniofacial development protein 2 (CFDP2) gene. The h-type BCNT proteins contain a highly conserved 82-amino acid region at the C terminus (BCNT-C) that is not present in p97BCNT. Instead ruminant p97BCNT contains a region derived from the endonuclease domain of a retrotransposable element RTE-1 [ (PUBMED:12832649) (PUBMED:16384818) ].

In addition to h-type BCNT proteins, a BCNT-C domain is also found in Drosophila YETI, a protein that binds to a microtubule-based motor kinesin-1, and the yeast SWR1-complex protein 5 (SWC5) or AOR1 (actin overexpression resistant 1), a component of the SWR1 chromatin remodeling complex [ (PUBMED:16384818) (PUBMED:14720462) ].

The entry represents the entire BCNT-C domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BCNT