The domain within your query sequence starts at position 1 and ends at position 123; the E-value for the BEX domain shown below is 3.9e-23.

MANVHQENEEMEQPLQNGQEDRPVGGGEGHQPAANNNNNNHNHNHNHHRRGQARRLAPNF
RWAIPNRQMNDGLGGDGDDMEMFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEF
CLM

BEX

BEX
PFAM accession number:PF04538
Interpro abstract (IPR021156):

This is a family of transcription elongation factors which includes those referred to as Bex (brain-expressed X-linked) proteins as well as those named TCEAL (transcription elongation factor A protein-like). Bex proteins are expressed in a wide range of tissues and are known to play a role in neuronal development. They seem to have have distinct roles in cancers [ (PUBMED:26408910) ]. Bex1 was shown to be a novel link between neurotrophin signalling, the cell cycle, and neuronal differentiation, suggesting it might function by coordinating internal cellular states with the ability of cells to respond to external signals [ (PUBMED:16498402) ]. TCEAL7 has been shown negatively to regulate the NF-kappaB pathway, hence being important in ovarian cancer as it one of the genes frequently downregulated in this cancer [ (PUBMED:19966855) (PUBMED:15870691) ]. Apart from TCEAL7, there are other five members of the TCEAL family, i.e. TCEAL1, TCEAL3, TCEAL4, TCEAL5 and TCEAL8. TCEAL1 was shown involved in the apoptosis of human cancer cells [ (PUBMED:10051408) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BEX