The domain within your query sequence starts at position 43 and ends at position 138; the E-value for the BLOC1_2 domain shown below is 6.9e-39.
RDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAEL QPYLDQINMIEEQVAALEQAAYKLDAYSKKLEAKYK
BLOC1_2 |
 |
|---|
| PFAM accession number: | PF10046 |
|---|---|
| Interpro abstract (IPR019269): | This entry represents a family of proteins that play a role in cellular proliferation, as well as in the biogenesis of specialised organelles of the endosomal-lysosomal system [ (PUBMED:15102850) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BLOC1_2