The domain within your query sequence starts at position 59 and ends at position 187; the E-value for the BNIP2 domain shown below is 7.7e-47.

KRKTLVAPEINISLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETDSLEFLGNGNELEW
EDDTPVATAKNMPGDSADLFGDGSAEDGSAANGRLWRTVIIGEQEHRIDLHMIRPYMKVV
THGGYYGEG

BNIP2

• PFAM accession number: PF12496
• Interpro abstract (IPR022181):

  This domain family is found in eukaryotes, and is typically between 119 and 133 amino acids in length. There is a conserved HGGY sequence motif. This family is Bcl2-/adenovirus E1B nineteen kDa-interacting protein 2. It interacts with pro- and anti- apoptotic molecules in the cell.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BNIP2