The domain within your query sequence starts at position 117 and ends at position 226; the E-value for the BRAP2 domain shown below is 3.5e-41.
NKMTSLKEDVRRSAMLCVLTVPATMTSHDLMKFVAPFNDVIEQMKIIRDSTPNQYMVLIK FSAQADADSFYMACNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMD
BRAP2 |
![]() |
---|
PFAM accession number: | PF07576 |
---|---|
Interpro abstract (IPR011422): | These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [ (PUBMED:9497340) ]. These proteins share a region of sequence similarity at their N terminus. They also have IPR001607 at the C terminus. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BRAP2