The domain within your query sequence starts at position 18 and ends at position 127; the E-value for the BSMAP domain shown below is 1.7e-62.

RGCRLFSICQFVDDGLDLNRTKLECESACTEAYSQPDEQYACHLGCQDQLPFAELRQEQL
MSLMPRMHLLFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQ

BSMAP

BSMAP
PFAM accession number:PF12280
Interpro abstract (IPR022065):

This family of proteins is found in eukaryotes. Proteins in this family are typically between 285 and 331 amino acids in length. BSMAP has a putative transmembrane domain and is predicted to be a type I membrane glycoprotein.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BSMAP