The domain within your query sequence starts at position 32 and ends at position 189; the E-value for the BSMAP domain shown below is 2.3e-43.
TAAAEAFDSVLGDTASCHRACQLTYPLHTYPKLMSLMPRMHLLFPLTLVRSFWSDMMDSA QSFITSSWTFYLQADDGKIVIFQSKPEIQYAPQLEQEPTNLRESSLSKMSYLQMRNSQAH RNYLEEEESDGFLRCLSLNSGWILTTTLVLSVMVLLWI
BSMAP |
---|
PFAM accession number: | PF12280 |
---|---|
Interpro abstract (IPR022065): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 285 and 331 amino acids in length. BSMAP has a putative transmembrane domain and is predicted to be a type I membrane glycoprotein. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BSMAP